Bradyrhizobium oligotrophicum: S58_29190 Help Entry S58_29190         CDS       T02484                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism aol  Bradyrhizobium oligotrophicum Pathway aol00261   Monobactam biosynthesis aol01100   Metabolic pathways aol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aol00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     S58_29190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aol01008]     S58_29190 Polyketide biosynthesis proteins [BR:aol01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     S58_29190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BAM88920 UniProt:  M4ZRR0 LinkDB All DBs Position 3288264..3288488 Genome browser AA seq 74 aa AA seqDB search MHAKTKLEEPAEENFIVVINDEEQYSIWSAERAVPDGWRSVGKRGTKAECLQHVEEVWTD MRPRSLRLRMSATS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgcatgccaagacgaagctggaggagccggcggaggaaaacttcatcgtcgtcatcaac gatgaagaacaatattccatctggtctgcagagcgtgcagttcccgatggctggcgatcg gttggcaagcgcggcacgaaggcggagtgcttgcagcacgtcgaagaagtctggaccgac atgaggccgcgaagcttgcgtcttcgcatgtcggcgacgtcgtaa

DBGET integrated database retrieval system