Amycolatopsis orientalis: SD37_16720 Help Entry SD37_16720        CDS       T06703                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism aori  Amycolatopsis orientalis Pathway aori00261   Monobactam biosynthesis aori01100   Metabolic pathways aori01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aori00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     SD37_16720  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aori01008]     SD37_16720 Polyketide biosynthesis proteins [BR:aori01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     SD37_16720 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ANN17123 UniProt:  A0A193BY78 LinkDB All DBs Position complement(3773087..3773311) Genome browser AA seq 74 aa AA seqDB search MPNPFEDPDAKYLVLVNDEGQHSLWPVFADVPAGWKSVFGESGRQECLDYIEKNWTDMRP KSLIEAMEKTAPAS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt gtgccaaatcctttcgaggacccggacgccaagtatctcgtcctggtcaatgacgagggt cagcattccctttggcccgttttcgccgatgtccccgccggatggaaatccgttttcggg gaatccggacgacaggaatgcctcgactacatcgaaaagaattggaccgacatgcgtccg aagagcctcatcgaggcgatggagaaaaccgcaccggcgtcatga

DBGET integrated database retrieval system