Actinoplanes oblitus: ACTOB_006488 Help Entry ACTOB_006488      CDS       T09687                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aou  Actinoplanes oblitus Pathway aou00261   Monobactam biosynthesis aou01100   Metabolic pathways aou01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aou00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ACTOB_006488  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aou01008]     ACTOB_006488 Polyketide biosynthesis proteins [BR:aou01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ACTOB_006488 BRITE hierarchy Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WIM94464 LinkDB All DBs Position complement(7264872..7265081) Genome browser AA seq 69 aa AA seqDB search MTNPFANENGSFFVLVNDEGQHSLWPAFAEQPAGWTVAHGAASRQECLAYVEQNWTDLRP KSLIAEIGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgccaacgaaaacggttccttttttgtgctcgtcaatgacgagggt cagcattcgctgtggccggccttcgccgagcagcccgccggctggaccgtggcccacggt gcggcgtcccgtcaggaatgccttgcctatgtcgagcagaactggacggacctgcggccg aagagcctgatcgccgagatcggcgcctga

DBGET integrated database retrieval system