Isoalcanivorax pacificus: S7S_05285 Help Entry S7S_05285         CDS       T03580                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism apac  Isoalcanivorax pacificus Pathway apac00261   Monobactam biosynthesis apac01100   Metabolic pathways apac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apac00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     S7S_05285  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:apac01008]     S7S_05285 Polyketide biosynthesis proteins [BR:apac01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     S7S_05285 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AJD47477 UniProt:  A0A0B4XMC9 LinkDB All DBs Position 1156979..1157206 Genome browser AA seq 75 aa AA seqDB search MTSCFDREDGEFRVLVNHEEQYSLWPAWKSIPGGWRDTGVSGARQHCLDYIEQTWTDMRP LSLRQWMDEQAAGQA NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaccagttgttttgaccgcgaggacggcgagttccgcgtcctggtgaaccatgaagag caatattccctgtggccggcctggaaaagcattcccggcggctggcgcgacaccggcgtc agcggtgcacgccagcactgcctcgactacatcgaacagacctggaccgatatgcgcccg ctgtcgctgcgccagtggatggacgagcaggcggccggccaggcatga

DBGET integrated database retrieval system