Anas platyrhynchos (mallard): 101793538 Help Entry 101793538         CDS       T02816                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism apla  Anas platyrhynchos (mallard) Pathway apla04010   MAPK signaling pathway apla04012   ErbB signaling pathway apla04068   FoxO signaling pathway apla04137   Mitophagy - animal apla04140   Autophagy - animal apla04150   mTOR signaling pathway apla04210   Apoptosis apla04218   Cellular senescence apla04370   VEGF signaling pathway apla04371   Apelin signaling pathway apla04540   Gap junction apla04625   C-type lectin receptor signaling pathway apla04810   Regulation of actin cytoskeleton apla04910   Insulin signaling pathway apla04912   GnRH signaling pathway apla04914   Progesterone-mediated oocyte maturation apla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:apla00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     101793538 (KRAS)    04012 ErbB signaling pathway     101793538 (KRAS)    04370 VEGF signaling pathway     101793538 (KRAS)    04371 Apelin signaling pathway     101793538 (KRAS)    04068 FoxO signaling pathway     101793538 (KRAS)    04150 mTOR signaling pathway     101793538 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     101793538 (KRAS)    04137 Mitophagy - animal     101793538 (KRAS)   09143 Cell growth and death    04210 Apoptosis     101793538 (KRAS)    04218 Cellular senescence     101793538 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     101793538 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     101793538 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     101793538 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     101793538 (KRAS)    04912 GnRH signaling pathway     101793538 (KRAS)    04914 Progesterone-mediated oocyte maturation     101793538 (KRAS)    04916 Melanogenesis     101793538 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apla04131]     101793538 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:apla04031]     101793538 (KRAS) Membrane trafficking [BR:apla04131]  Endocytosis   Macropinocytosis    Ras GTPases     101793538 (KRAS) GTP-binding proteins [BR:apla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     101793538 (KRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase ATP_bind_1 FeoB_N Septin Motif Other DBs NCBI-GeneID:  101793538 NCBI-ProteinID:  XP_027305805 Ensembl:  ENSAPLG00000015953 EnsemblRapid:  ENSAPLG00030031897 LinkDB All DBs Position 1:75278883..75305016 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDL PSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRVKKISKEEKTPGC VKIKKCLVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacagaatataagcttgttgtcgttggagctggtggtgtaggcaagagtgccttgaca atacagctaattcagaatcactttgtggatgaatatgaccctacaatagaggattcctac aggaagcaagtagtaatcgatggggaaacctgtctcttggatattcttgatacagcaggt caagaagaatatagtgcaatgagggaccaatacatgagaacaggagaaggtttcctgtgt gtatttgctataaacaatacaaaatcttttgaagatattcaccattatagggaacaaata aaaagagttaaagactctgaagatgtccccatggtgctagtaggaaacaaatgtgatttg ccttccagaacagtagatacaaaacaagctcaggatttagcaagaagttacggaattcct ttcattgaaacatcagcaaaaacaagacagagagtggaggatgctttttatacattggtg cgagagattcgacagtacagagtgaaaaaaatcagcaaagaagaaaagactccagggtgc gtgaaaattaaaaaatgccttgtaatgtaa

DBGET integrated database retrieval system