Agrilus planipennis (emerald ash borer): 108737639 Help Entry 108737639         CDS       T07419                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism apln  Agrilus planipennis (emerald ash borer) Pathway apln04013   MAPK signaling pathway - fly apln04068   FoxO signaling pathway apln04137   Mitophagy - animal apln04140   Autophagy - animal apln04150   mTOR signaling pathway apln04213   Longevity regulating pathway - multiple species apln04214   Apoptosis - fly apln04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:apln00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     108737639    04068 FoxO signaling pathway     108737639    04150 mTOR signaling pathway     108737639  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108737639    04137 Mitophagy - animal     108737639   09143 Cell growth and death    04214 Apoptosis - fly     108737639  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     108737639   09149 Aging    04213 Longevity regulating pathway - multiple species     108737639  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:apln04131]     108737639   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:apln04031]     108737639 Membrane trafficking [BR:apln04131]  Endocytosis   Macropinocytosis    Ras GTPases     108737639 GTP-binding proteins [BR:apln04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108737639 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N TPP_enzyme_M Septin Motif Other DBs NCBI-GeneID:  108737639 NCBI-ProteinID:  XP_018326102 UniProt:  A0A1W4X007 LinkDB All DBs Position Unknown AA seq 193 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL SAWAVDMAQAREVAKQYGIPFVETSAKTRMGVDDAFYTLVREIRKDKASRGKHKSPKMGI HGRVPFKFRCTIL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgactgaatacaaactagttgttgtgggcgctggtggtgtcgggaaatcggcactaaca atccagcttatacaaaatcatttcgttgacgaatatgatcccacaattgaagactcatac cgtaaacaagttgtaatagatggagagacttgcttattagatatcttagatacagcaggc caagaagaatacagtgctatgagggaccagtatatgcgaacaggagaaggttttctctta gtttttgctgttaactctgccaaaagctttgaagatattggtacatacagggagcaaata aagagagttaaggatgcagaagaagtgccaatggttcttgttggaaataaatgtgacttg tctgcctgggctgtagatatggctcaagctcgtgaggttgccaaacagtatggcattcca tttgtggaaacttcagctaaaacaaggatgggagttgatgatgccttttacacattagtg agggagattcgcaaagataaagcaagcaggggcaagcacaagtctccgaaaatgggcata cacggtcgtgtgccttttaagtttcgctgtaccattctctaa

DBGET integrated database retrieval system