Actinosynnema pretiosum: CNX65_24930 Help Entry CNX65_24930       CDS       T05092                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism apre  Actinosynnema pretiosum Pathway apre00261   Monobactam biosynthesis apre01100   Metabolic pathways apre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:apre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CNX65_24930  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:apre01008]     CNX65_24930 Polyketide biosynthesis proteins [BR:apre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CNX65_24930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ATE56117 UniProt:  A0A290ZAT6 LinkDB All DBs Position complement(5896247..5896441) Genome browser AA seq 64 aa AA seqDB search MSNPFDDAEGVFHVLVNAEGQHSLWPAFAEVPAGWDPVFGPGGREACVAYVEENWTDLRP VSLR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccgttcgacgacgccgagggcgtcttccacgtgctggtgaacgcggagggg cagcactcgctgtggcccgcgttcgcggaggtgcccgcgggctgggacccggtgttcggg cccggcgggcgcgaggcgtgcgtggcgtacgtggaggagaactggaccgacctgcggccg gtgagcctgcggtga

DBGET integrated database retrieval system