Amycolatopsis sp. FBCC-B4732: MUY14_12385 Help Entry MUY14_12385       CDS       T08335                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism aprt  Amycolatopsis sp. FBCC-B4732 Pathway aprt00261   Monobactam biosynthesis aprt01100   Metabolic pathways aprt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:aprt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MUY14_12385  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:aprt01008]     MUY14_12385 Polyketide biosynthesis proteins [BR:aprt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MUY14_12385 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH MC_hydratase Motif Other DBs NCBI-ProteinID:  UOX91376 LinkDB All DBs Position 2921176..2921385 Genome browser AA seq 69 aa AA seqDB search MTNPFEDPDGTYLVLVNAENQHSLWPASADVPAGWTVAFGPSGRQACLDHVEANWTDMRP KSLADAMDD NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaagaccccgacggcacgtacctggtgctggtcaacgcggagaac cagcacagcctctggccggcgtccgccgacgtcccggcgggctggacggtggccttcggg ccgtccggccgccaggcgtgcctcgaccacgtggaagcgaactggacggacatgcggccg aagtccctggccgacgccatggacgactga

DBGET integrated database retrieval system