Aquimarina sp. AD10: D1816_16450 Help Entry D1816_16450       CDS       T05712                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aqd  Aquimarina sp. AD10 Pathway aqd00790   Folate biosynthesis aqd01100   Metabolic pathways aqd01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:aqd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     D1816_16450 (folB) Enzymes [BR:aqd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      D1816_16450 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      D1816_16450 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      D1816_16450 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AXT61881 UniProt:  A0A3A9W9Q9 LinkDB All DBs Position 3989906..3990262 Genome browser AA seq 118 aa AA seqDB search MGYIKLKNIKVYAYHGCLVEEKKIGSDYRVDLKIKGDLSNSAQTDRLADTIDYVHLNHIV KEEMAIRSKLLEHAAERILNRIIVELPLVQKATVDVSKINPPIGGNVEMVTITRTKKR NT seq 357 nt NT seq  +upstreamnt  +downstreamnt gtgggatatatcaaactgaaaaatattaaagtttatgcctatcatggttgtcttgttgaa gaaaaaaaaataggttctgattatcgagtagatttaaaaattaaaggtgatctatctaat tctgcacaaaccgatcgtttggcggatactatagattacgttcatctaaatcatattgta aaagaagagatggcgatacgttctaagctactagaacatgcagcagagcgtattttaaat agaatcatagtagagttacctttggttcaaaaagcgaccgtagatgtctctaaaatcaat cctcctattggtggaaatgtagaaatggtaacaattaccagaaccaaaaaacgctaa

DBGET integrated database retrieval system