Arthrobacter sp. ERGS1 01: AL755_09840 Help Entry AL755_09840       CDS       T04085                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism are  Arthrobacter sp. ERGS1:01 Pathway are00261   Monobactam biosynthesis are01100   Metabolic pathways are01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:are00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AL755_09840  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:are01008]     AL755_09840 Polyketide biosynthesis proteins [BR:are01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AL755_09840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALE07720 UniProt:  A0A0M4LEF6 LinkDB All DBs Position complement(1326768..1326956) Genome browser AA seq 62 aa AA seqDB search MNATFRVLVNDLQQHSLWPTFADVPNGWMVMYGPAGRQECLDFVSRSWTDMTPRTVAELA AS NT seq 189 nt NT seq  +upstreamnt  +downstreamnt atgaacgcaaccttccgcgtattggtcaatgacctgcagcaacattcgctgtggcccacc ttcgccgatgttccaaacggctggatggtcatgtacggcccggccggccggcaggagtgc ctggactttgtctcgcgcagctggacggacatgaccccgcgcacggtggccgaacttgcg gcctcctag

DBGET integrated database retrieval system