Rhizobium rhizogenes K599: B0909_06635 Help Entry B0909_06635       CDS       T04767                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aro  Rhizobium rhizogenes K599 Pathway aro00790   Folate biosynthesis aro01100   Metabolic pathways aro01240   Biosynthesis of cofactors Module aro_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:aro00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     B0909_06635 (folB) Enzymes [BR:aro01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      B0909_06635 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      B0909_06635 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      B0909_06635 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DinI Motif Other DBs NCBI-ProteinID:  AQS61968 UniProt:  A0AA86HPQ3 LinkDB All DBs Position 1:1027752..1028117 Genome browser AA seq 121 aa AA seqDB search MSRYTIILKNCSFFARHGLLEQEEVLGQRFFVDAEMEVEAGDALETDDIENTVDYGVAFA VIEKIVVGQRRYLIEALANDIAKALRARYPQIVWLRITVRKPSAPVPGILDYAQVSVEHR A NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgagccgctataccatcatcctgaaaaactgttcctttttcgcccgtcatggtcttctc gagcaggaggaagtgctgggccagcgctttttcgtcgatgccgagatggaggtcgaggcc ggtgatgcgctggaaaccgacgatatcgaaaacaccgtcgattatggcgtggccttcgcc gtcatcgaaaagattgtcgtcggtcagcgccgttatctcatcgaggcgctggcgaatgac atcgccaaggcgctgcgcgcccgttacccgcagatcgtctggctgcgcatcacggtgcgc aaaccgtcggcacctgttcccggcattctcgattatgcgcaggtgagcgttgaacaccgt gcctga

DBGET integrated database retrieval system