Athalia rosae (coleseed sawfly): 105688643 Help Entry 105688643         CDS       T09776                                  Name (RefSeq) ras-like protein 1   KO K07827   GTPase KRas Organism aroa  Athalia rosae (coleseed sawfly) Pathway aroa04013   MAPK signaling pathway - fly aroa04068   FoxO signaling pathway aroa04137   Mitophagy - animal aroa04140   Autophagy - animal aroa04150   mTOR signaling pathway aroa04213   Longevity regulating pathway - multiple species aroa04214   Apoptosis - fly aroa04320   Dorso-ventral axis formation Brite KEGG Orthology (KO) [BR:aroa00001]  09130 Environmental Information Processing   09132 Signal transduction    04013 MAPK signaling pathway - fly     105688643    04068 FoxO signaling pathway     105688643    04150 mTOR signaling pathway     105688643  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105688643    04137 Mitophagy - animal     105688643   09143 Cell growth and death    04214 Apoptosis - fly     105688643  09150 Organismal Systems   09158 Development and regeneration    04320 Dorso-ventral axis formation     105688643   09149 Aging    04213 Longevity regulating pathway - multiple species     105688643  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:aroa04131]     105688643   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:aroa04031]     105688643 Membrane trafficking [BR:aroa04131]  Endocytosis   Macropinocytosis    Ras GTPases     105688643 GTP-binding proteins [BR:aroa04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     105688643 BRITE hierarchy Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Motif Other DBs NCBI-GeneID:  105688643 NCBI-ProteinID:  XP_012260550 EnsemblRapid:  ENSAEAG00005001639 LinkDB All DBs Position 1:5768948..5772702 Genome browser AA seq 193 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLLVFAVNSAKSFEDIGTYREQIKRVKDAEEVPMVLVGNKCDL QSWAVNMTQAREVARQYGVPFVETSAKTRMGVDDAFYTLVREIRRDKEQRGKEKRKRMRA RSSGRRRHRCCLL NT seq 582 nt NT seq  +upstreamnt  +downstreamnt atgacggaatataagctggtcgtcgtaggggctggaggtgttggcaaatccgctcttact atacaacttattcaaaaccattttgtggatgagtatgatccaacgatagaagactcctac agaaaacaggttgttatagatggtgaaacttgtttattggacatcttagacactgctggt caggaagagtacagtgcgatgagggaccaatatatgagaactggtgaaggatttctgcta gtctttgccgtaaactctgccaaaagttttgaagatattggaacttatagagaacaaata aagcgggtaaaagacgccgaagaggtgccaatggtgttagtcggaaacaaatgtgacctc cagtcatgggctgtaaatatgacacaggcaagagaagtagctcgccaatatggtgtacca ttcgttgaaacttctgccaaaactagaatgggagtagacgatgctttctataccctggtg agagaaatccgtagagataaagaacaaagaggtaaggagaaacggaagcgcatgagagca agaagttctggacgtcgaaggcatcgttgctgccttctataa

DBGET integrated database retrieval system