Arthrobacter sp. U41: ASPU41_06870 Help Entry ASPU41_06870      CDS       T05053                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism aru  Arthrobacter sp. U41 Pathway aru00790   Folate biosynthesis aru01100   Metabolic pathways aru01240   Biosynthesis of cofactors Module aru_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:aru00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     ASPU41_06870 Enzymes [BR:aru01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      ASPU41_06870  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      ASPU41_06870  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      ASPU41_06870 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AOT03104 UniProt:  A0A1C9WPG0 LinkDB All DBs Position 1479447..1479815 Genome browser AA seq 122 aa AA seqDB search MDQITLSGVTAVGHHGVFDFERRNGQPFVVDAVLHLDFSRAAASDDVLDTAHYGEVAECI RGWITGEPLNLIEALAVRIAEEVLRRFPVTAVDITVHKPKAPIAVEFGDVSVSVRRARQV QP NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggaccagatcacgctgagcggcgtcaccgccgtcggccatcacggagtgtttgatttc gagcggcgcaatggccagccgttcgtggtcgacgccgtgctgcacctggatttcagccgc gccgccgcctccgacgacgttctggacaccgcgcactacggtgaagtggccgaatgcatc cggggctggatcacgggggagccgctgaacctgatcgaggcgctggccgtgcggatcgcc gaggaggtgctgcggaggttccccgtcaccgcggtagacatcaccgtgcacaaacccaag gctcccatcgcagtggagttcggcgacgtctccgtcagcgtccggcgggcccgacaggtg cagccatga

DBGET integrated database retrieval system