Arachnia rubra: J5A65_03785 Help Entry J5A65_03785       CDS       T07339                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism arub  Arachnia rubra Pathway arub00261   Monobactam biosynthesis arub01100   Metabolic pathways arub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arub00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     J5A65_03785  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:arub01008]     J5A65_03785 Polyketide biosynthesis proteins [BR:arub01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     J5A65_03785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  QUC08864 LinkDB All DBs Position 857948..858151 Genome browser AA seq 67 aa AA seqDB search MNPFDDTSADFLILVNLENQHSLWPVFADIPHGWRQVAGPLPHGEAMAWVDENWTDMRPA SLIAAMD NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaatccatttgatgacacatctgctgatttcctgatccttgttaatttagagaatcag cattccttatggcctgtgttcgctgatatcccgcatggctggagacaggttgcaggtccg ctcccacacggggaggcgatggcctgggtcgatgaaaactggactgatatgcgacccgcc tcgctcatagccgcgatggattag

DBGET integrated database retrieval system