Arthrobacter alpinus A3: MB46_06400 Help Entry MB46_06400        CDS       T04228                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism arw  Arthrobacter alpinus A3 Pathway arw00261   Monobactam biosynthesis arw01100   Metabolic pathways arw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:arw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     MB46_06400  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:arw01008]     MB46_06400 Polyketide biosynthesis proteins [BR:arw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     MB46_06400 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ALV45190 UniProt:  A0A0U3H193 LinkDB All DBs Position 1479834..1480046 Genome browser AA seq 70 aa AA seqDB search MTNPFDDTNATFRVLVNDLQQHSLWPSFADVPNGWMVMYGPAGRQECLDFVSRSWTDMTP RTVAELAASQ NT seq 213 nt NT seq  +upstreamnt  +downstreamnt gtgacgaacccatttgatgacacgaacgcaaccttccgcgtattggtcaatgacctacaa caacactcgttgtggccttcttttgccgacgtacccaatggctggatggttatgtacggc cctgctggcaggcaggagtgcctggatttcgtctcccgcagctggacggacatgacgccg cgcacggttgccgaacttgcggcttcacagtga

DBGET integrated database retrieval system