Arthrobacter sp. ATCC 21022: AUT26_00580 Help Entry AUT26_00580       CDS       T04477                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism arz  Arthrobacter sp. ATCC 21022 Pathway arz00790   Folate biosynthesis arz01100   Metabolic pathways arz01240   Biosynthesis of cofactors Module arz_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:arz00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AUT26_00580 Enzymes [BR:arz01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AUT26_00580  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AUT26_00580  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AUT26_00580 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AMB38893 LinkDB All DBs Position 120663..121022 Genome browser AA seq 119 aa AA seqDB search MDRITLTGVTAVGHHGVFDFERREGQPFVVDAVLYTDFTKAAETDDLQFTAHYGEVAGLI TKHIEGEPLNLIEGLAVRIAEDILANYGVSAVDVTVHKPKAPIEVPFGDVAVSVHRERT NT seq 360 nt NT seq  +upstreamnt  +downstreamnt gtggacaggatcacgctgaccggtgtcaccgccgtcggccaccatggagtgttcgacttc gaacgccgtgagggccagccattcgtggtggatgcggtgctttacacggacttcaccaag gccgccgagacggacgatctgcagttcacagcgcattatggcgaggtggccgggctcatc accaagcacatcgagggtgagccgttgaacctgattgagggccttgccgtacgcatcgcg gaggacatcctggccaattacggtgtgtccgccgtcgacgtgacggttcataagcccaag gcgcccattgaggtgccgttcggggacgtcgctgtcagcgtgcatcgggagcggacatga

DBGET integrated database retrieval system