Anolis sagrei ordinatus (Brown anole): 132763991 Help Entry 132763991         CDS       T09595                                  Name (RefSeq) ferritin heavy chain B-like   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao00860   Porphyrin metabolism asao04216   Ferroptosis asao04217   Necroptosis Brite KEGG Orthology (KO) [BR:asao00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     132763991  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     132763991    04217 Necroptosis     132763991  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:asao04147]     132763991 Enzymes [BR:asao01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      132763991 Exosome [BR:asao04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    132763991   Exosomal proteins of bladder cancer cells    132763991 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin Motif Other DBs NCBI-GeneID:  132763991 NCBI-ProteinID:  XP_060613776 LinkDB All DBs Position Unknown AA seq 92 aa AA seqDB search KPEKDEWENSLVAFESALRLESILNQALLDLHHLALQKGDPHMCDFLKSFLEDQVAAVKE LGSYISNLRRLEVPHNGLGEHLFDQHSFTESA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt aagccagaaaaggatgaatgggagaacagtttggtggcctttgagagcgccttgcggctg gagagcatcctgaaccaagctctcctggatttgcaccatctcgctctgcagaaaggggat ccgcacatgtgcgacttcctaaagtccttcttggaggaccaggtggcagctgtcaaggag ctagggagctacatttccaacctgcggcgcctggaagtgccccacaacggcctgggggag cacctcttcgatcagcactccttcacagagagtgcctga

DBGET integrated database retrieval system