Anolis sagrei ordinatus (Brown anole): 132775705 Help Entry 132775705         CDS       T09595                                  Symbol KRAS Name (RefSeq) GTPase KRas isoform X1   KO K07827   GTPase KRas Organism asao  Anolis sagrei ordinatus (Brown anole) Pathway asao04010   MAPK signaling pathway asao04012   ErbB signaling pathway asao04068   FoxO signaling pathway asao04137   Mitophagy - animal asao04140   Autophagy - animal asao04150   mTOR signaling pathway asao04210   Apoptosis asao04218   Cellular senescence asao04370   VEGF signaling pathway asao04371   Apelin signaling pathway asao04540   Gap junction asao04625   C-type lectin receptor signaling pathway asao04810   Regulation of actin cytoskeleton asao04910   Insulin signaling pathway asao04912   GnRH signaling pathway asao04914   Progesterone-mediated oocyte maturation asao04916   Melanogenesis Brite KEGG Orthology (KO) [BR:asao00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     132775705 (KRAS)    04012 ErbB signaling pathway     132775705 (KRAS)    04370 VEGF signaling pathway     132775705 (KRAS)    04371 Apelin signaling pathway     132775705 (KRAS)    04068 FoxO signaling pathway     132775705 (KRAS)    04150 mTOR signaling pathway     132775705 (KRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     132775705 (KRAS)    04137 Mitophagy - animal     132775705 (KRAS)   09143 Cell growth and death    04210 Apoptosis     132775705 (KRAS)    04218 Cellular senescence     132775705 (KRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     132775705 (KRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     132775705 (KRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     132775705 (KRAS)   09152 Endocrine system    04910 Insulin signaling pathway     132775705 (KRAS)    04912 GnRH signaling pathway     132775705 (KRAS)    04914 Progesterone-mediated oocyte maturation     132775705 (KRAS)    04916 Melanogenesis     132775705 (KRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:asao04131]     132775705 (KRAS)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:asao04031]     132775705 (KRAS) Membrane trafficking [BR:asao04131]  Endocytosis   Macropinocytosis    Ras GTPases     132775705 (KRAS) GTP-binding proteins [BR:asao04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     132775705 (KRAS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase G-alpha ATP_bind_1 FeoB_N ThiF Septin Motif Other DBs NCBI-GeneID:  132775705 NCBI-ProteinID:  XP_060632508 LinkDB All DBs Position Unknown AA seq 210 aa AA seqDB search MYVLEATKGPRAGDRERGLRKMTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDS YRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQ IKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTL VREIRQYRLRKINTEEKTPGCVKIKKCLLM NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgtacgtcctagaagcaactaaaggacctcgggcaggagacagagagaggggcctacgg aaaatgacggagtacaaacttgtcgtggttggagctggtggcgtaggtaaaagcgcactg acgatacagcttatccagaaccattttgtagatgaatacgatcctacaatagaggattcc tacaggaaacaagtagtcatcgatggcgaaacctgcctcttggacattttggatacagcc ggccaagaagagtacagcgcaatgcgggaccagtacatgagaacgggcgagggcttttta tgcgtatttgctataaataacacaaagtcttttgaagacatccatcattacagggaacag ataaaaagagtgaaagattcggaagacgtccctatggtgctagtaggaaacaaatgtgac ttgccttccaggactgtagatacaaaacaagctcaggacttagcaaggagttacggaatc cctttcatcgaaacctcggcaaaaacgagacagagagtggaggatgctttttatacattg gtgcgagagatccgtcaatacagattgagaaaaatcaacacagaagaaaagactcctggg tgcgtgaaaattaaaaaatgccttttaatgtga

DBGET integrated database retrieval system