Actinoplanes sp. SE50/110: ACPL_4115 Help Entry ACPL_4115         CDS       T02044                                  Name (GenBank) Protein mbtH   KO K05375   MbtH protein Organism ase  Actinoplanes sp. SE50/110 Pathway ase00261   Monobactam biosynthesis ase01100   Metabolic pathways ase01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ase00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     ACPL_4115  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:ase01008]     ACPL_4115 Polyketide biosynthesis proteins [BR:ase01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     ACPL_4115 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Emfourin Motif Other DBs NCBI-ProteinID:  AEV85010 UniProt:  G8S6Y1 LinkDB All DBs Position 4537184..4537393 Genome browser AA seq 69 aa AA seqDB search MNDEQTDERTYRVVVNDEEQYSIWLADRDLPPGWSAEGTTGDRATCLAHIDRVWTDMRPL SLRRLMAGA NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaacgacgagcagacggacgagcgcacctaccgggtggtcgtcaacgacgaggagcag tactccatctggttggccgaccgggacctgccgccgggctggtccgccgagggcacgacc ggtgaccgggccacgtgcctcgcccacatcgaccgcgtctggaccgacatgcggccgctg agcctgcgtcgcctgatggccggtgcctga

DBGET integrated database retrieval system