Alistipes shahii: AL1_06920 Help Entry AL1_06920         CDS       T02578                                  Name (GenBank) 4Fe-4S binding domain.   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ash  Alistipes shahii Pathway ash00020   Citrate cycle (TCA cycle) ash01100   Metabolic pathways ash01110   Biosynthesis of secondary metabolites ash01120   Microbial metabolism in diverse environments ash01200   Carbon metabolism ash01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:ash00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     AL1_06920 Enzymes [BR:ash01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      AL1_06920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_6 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_4 Fer4_15 Fer4_16 Fer4_13 Fer4_3 Fer4_22 Fer4_8 DUF2284 Motif Other DBs NCBI-ProteinID:  CBK63288 UniProt:  D4IK26 LinkDB All DBs Position complement(796966..797193) Genome browser AA seq 75 aa AA seqDB search MAKIKGTIVVDKERCKGCGVCASACPCDVLALSAEVNSKGYPVAWMVNPDSCTGCASCAV ICPDSCITVYRQKFE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaatcaaaggaacaatcgttgtcgacaaggagcgctgcaaggggtgcggggtc tgtgcttcggcctgtccgtgcgacgtgctcgcgctgtcggcggaggtcaacagcaaaggt tatcccgttgcgtggatggtcaatcccgattcctgcacgggctgtgcctcctgtgcggtg atttgtccggatagctgcattacggtttatcgtcaaaaattcgagtaa

DBGET integrated database retrieval system