Asticcacaulis sp. ZE23SCel15: Q1W73_08735 Help Entry Q1W73_08735       CDS       T09907                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism asti  Asticcacaulis sp. ZE23SCel15 Pathway asti00790   Folate biosynthesis asti01100   Metabolic pathways asti01240   Biosynthesis of cofactors Module asti_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:asti00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Q1W73_08735 (folB) Enzymes [BR:asti01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Q1W73_08735 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Q1W73_08735 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Q1W73_08735 (folB) BRITE hierarchy Motif Pfam:  FolB Eryth_link_C DUF1565 Motif Other DBs NCBI-ProteinID:  WKL55793 LinkDB All DBs Position complement(1950693..1951046) Genome browser AA seq 117 aa AA seqDB search MSLKSRKIFVRGLKVEAAIGIYDHEHGRTQPLIIDAVITVGTHPIHGLKDTLNYELVGQF ARDIIARGHIKLVESLAEDIATHLLELAIVRSVEVTINKPEALSDADQAGCTVVMER NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgagcctgaaatcccgtaagattttcgtccggggtttaaaggttgaggccgcgatcggg atctatgaccacgaacatggccgcacccagcccctgattatcgatgccgtcattaccgtc ggcacccatcccatccacggcctgaaagacacgctcaattacgagttggtcgggcagttt gcgcgcgatatcatcgcccgcggccatatcaagctggtcgagtctctggctgaagacatc gccacccacctgctggaactggctatcgttaggtctgtcgaggtcaccatcaacaaaccc gaagccctgtccgatgccgaccaagccggctgcaccgtagttatggagcgatga

DBGET integrated database retrieval system