Alkalitalea saponilacus: CDL62_01480 Help Entry CDL62_01480       CDS       T04906                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism asx  Alkalitalea saponilacus Pathway asx00020   Citrate cycle (TCA cycle) asx01100   Metabolic pathways asx01110   Biosynthesis of secondary metabolites asx01120   Microbial metabolism in diverse environments asx01200   Carbon metabolism asx01210   2-Oxocarboxylic acid metabolism Module asx_M00009   Citrate cycle (TCA cycle, Krebs cycle) asx_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:asx00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CDL62_01480 Enzymes [BR:asx01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CDL62_01480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_16 Fer4_2 Fer4_9 Fer4_15 Fer4_4 Fer4_3 Fer4_22 Fer4_17 Fer4_8 Fer4_13 Motif Other DBs NCBI-ProteinID:  ASB47913 UniProt:  A0A1T5GAT5 LinkDB All DBs Position complement(395656..395892) Genome browser AA seq 78 aa AA seqDB search MAKVRGAIVVDTVTCKGCSLCVESCPTDVIRLAAEVNAKGYNYAYMENPEACIGCANCAM VCPDSCITVYKVKVAEAV NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagttagaggtgcaattgtggtggatacggtaacctgcaaaggttgttctctt tgtgtagagtcttgtcccaccgatgttatccgtctggctgcggaggtaaacgcaaaagga tacaattacgcttatatggagaacccggaggcttgtatcggatgcgccaattgtgcaatg gtatgtccagatagttgtatcactgtttataaagttaaagttgctgaagctgtctga

DBGET integrated database retrieval system