Arabidopsis thaliana (thale cress): AT5G51940 Help Entry AT5G51940         CDS       T00041                                  Symbol NRPB6A Name (RefSeq) RNA polymerase Rpb6   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism ath  Arabidopsis thaliana (thale cress) Pathway ath03020   RNA polymerase ath03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:ath00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     AT5G51940 (NRPB6A)   09124 Replication and repair    03420 Nucleotide excision repair     AT5G51940 (NRPB6A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:ath03021]     AT5G51940 (NRPB6A)    03400 DNA repair and recombination proteins [BR:ath03400]     AT5G51940 (NRPB6A) Transcription machinery [BR:ath03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      AT5G51940 (NRPB6A)   RNA polymerase III system    RNA polymerase III      AT5G51940 (NRPB6A)   RNA polymerase I system    RNA polymerase I      AT5G51940 (NRPB6A) DNA repair and recombination proteins [BR:ath03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       AT5G51940 (NRPB6A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  835269 NCBI-ProteinID:  NP_200007 TAIR:  AT5G51940 UniProt:  Q9FJ98 A0A178UA32 Structure PDB LinkDB All DBs Position 5:21104551..21105947 Genome browser AA seq 144 aa AA seqDB search MADEDYNDVDDLGYEDEPAEPEIEEGVEEDVEMKENDDVNGEPIEAEDKVETEPVQRPRK TSKFMTKYERARILGTRALQISMNAPVMVELEGETDPLEIAMKELRQRKIPFTIRRYLPD GSFEEWGVDELIVEDSWKRQVGGD NT seq 435 nt NT seq  +upstreamnt  +downstreamnt atggctgacgaagattacaacgacgtcgatgacttgggatatgaggatgagccagcagag cctgagattgaagaaggagtagaggaagatgttgaaatgaaggagaatgatgatgtcaat ggtgagcctattgaagctgaagataaagtcgaaacagaacctgtgcaacgtccacgcaaa acgtcaaagtttatgaccaagtatgagcgtgctcgtatcctcggcactcgcgctttgcag attagcatgaatgctcctgtcatggttgagctagagggtgagactgatccacttgagatt gcgatgaaggagcttaggcagcggaagataccattcactattagacgctatctacctgat gggagtttcgaggaatggggagttgatgaactgatcgtggaagactcatggaaacgtcaa gttggtggtgattga

DBGET integrated database retrieval system