Actinocatenispora thailandica: Athai_48780 Help Entry Athai_48780       CDS       T07045                                  Symbol mbtH Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism atl  Actinocatenispora thailandica Pathway atl00261   Monobactam biosynthesis atl01100   Metabolic pathways atl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Athai_48780 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:atl01008]     Athai_48780 (mbtH) Polyketide biosynthesis proteins [BR:atl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Athai_48780 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  BCJ37375 UniProt:  A0A7R7DTA9 LinkDB All DBs Position 5413105..5413311 Genome browser AA seq 68 aa AA seqDB search MADELHSVVHNDEGQYSTWPADRELPAGWHRSGFTGPRNDCLDHVEKVWTDLRPASLRAA TEQAGNRD NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccgacgagctgcacagcgtggtgcacaacgacgaaggtcagtactcgacctggccg gccgatcgcgagctgccggccggctggcaccggtccggcttcaccgggccgcggaacgac tgcctggatcacgtcgagaaggtctggaccgacctgcggccggccagcctgcgggcggcg accgagcaggccggcaaccgtgactga

DBGET integrated database retrieval system