Aureimonas sp. AU20: M673_09390 Help Entry M673_09390        CDS       T04161                                  Name (GenBank) hypothetical protein   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism aua  Aureimonas sp. AU20 Pathway aua00260   Glycine, serine and threonine metabolism aua01100   Metabolic pathways Module aua_M00975   Betaine degradation, bacteria, betaine => pyruvate Brite KEGG Orthology (KO) [BR:aua00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     M673_09390 Enzymes [BR:aua01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      M673_09390     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      M673_09390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  ALN72930 UniProt:  A0A0S2ENT2 LinkDB All DBs Position complement(2080220..2080561) Genome browser AA seq 113 aa AA seqDB search MLLITCPYCGPRPELEFRYAGEAHVVRAETPSEIGADEWGAFLYTRANPRGLHAERWRHI HGCARFFNALRDTRTDFFEATYEVGQPRPSGTEENKPALSGDNVGTWSGESAR NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgcttctgatcacctgcccttattgcggaccccgccccgagctcgaattccgctatgcc ggcgaagcgcatgtcgtgcgcgccgagacgccgtccgagatcggcgcggacgagtggggc gcctttctctacacgcgcgccaatccgcgcggtctccacgccgagcgctggcgccacatt cacggctgcgcccgcttcttcaacgcgctgcgcgacacgcgaaccgacttcttcgaggcg acctacgaggtcggccagccgcgcccctccggtaccgaagagaacaagccggctctcagc ggcgacaatgtcggcacctggtccggggagagcgctcgatga

DBGET integrated database retrieval system