Azotobacter vinelandii CA6: AvCA6_25630 Help Entry AvCA6_25630       CDS       T02634                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism avd  Azotobacter vinelandii CA6 Pathway avd00261   Monobactam biosynthesis avd01100   Metabolic pathways avd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avd00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AvCA6_25630  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:avd01008]     AvCA6_25630 Polyketide biosynthesis proteins [BR:avd01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AvCA6_25630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGK20708 UniProt:  M9YNH3 LinkDB All DBs Position complement(2606854..2607096) Genome browser AA seq 80 aa AA seqDB search MISVFDREDIVFQVVVNHEEQYSIWPDYKEIPKGWRKAGKSGFKKECLAYIEEVWTDMRP LSLRKKMEAMAKEREGAAAN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgatttctgttttcgatcgcgaggacatcgttttccaggtcgtcgtcaaccatgaggag cagtactccatctggccggactacaaggaaatccccaagggttggcgcaaggcaggcaag agcggcttcaagaaggaatgcctggcctacatcgaggaggtgtggaccgacatgcgtccc ctgagcctgcgcaagaagatggaggcgatggccaaggagcgcgaaggcgccgccgcgaac tga

DBGET integrated database retrieval system