Agrobacterium vitis VAR03-1: RvVAR031_19810 Help Entry RvVAR031_19810    CDS       T08810                                  Symbol folB Name (GenBank) 7,8-dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism avf  Agrobacterium vitis VAR03-1 Pathway avf00790   Folate biosynthesis avf01100   Metabolic pathways avf01240   Biosynthesis of cofactors Module avf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:avf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RvVAR031_19810 (folB) Enzymes [BR:avf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      RvVAR031_19810 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      RvVAR031_19810 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      RvVAR031_19810 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BCH54371 UniProt:  A0A125P3U1 LinkDB All DBs Position 1:2160470..2160838 Genome browser AA seq 122 aa AA seqDB search MAETYTITLKNCGFFARHGLHEQEKFLGQRFFIDAELELRFSSALETDELAGTVDYGVAF NLIEEIVTGKRRYLIEALALDIAKSLCERFEQILRAKITVRKPSAPITGMLDYVEVSVDH HR NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggctgagacctatacaatcacactgaagaattgcgggtttttcgcccggcacggcctg catgagcaggagaagtttctgggtcagcggtttttcatcgatgccgaactggagctgcgg ttttcctcggctctggaaaccgatgaactggccggaacggtggattatggcgtagccttc aacctcatcgaagaaatcgtcaccggcaagcggcgttatctgatcgaggctttggcgctg gatatcgccaaatcgctctgtgagaggttcgaacagattctgcgtgcgaaaatcactgtg cgcaagccgagcgcgccgattaccggcatgctcgattatgtcgaggtttccgttgaccat catcgataa

DBGET integrated database retrieval system