Azotobacter vinelandii CA: AvCA_50380 Help Entry AvCA_50380        CDS       T02633                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism avl  Azotobacter vinelandii CA Pathway avl00261   Monobactam biosynthesis avl01100   Metabolic pathways avl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AvCA_50380  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:avl01008]     AvCA_50380 Polyketide biosynthesis proteins [BR:avl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AvCA_50380 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGK15782 LinkDB All DBs Position complement(5108719..5108922) Genome browser AA seq 67 aa AA seqDB search MNFDQADTQFQVVVNAERQYSIWPEYKPVPAGWQEIGICGDRQTCLAHISGIWSDMRPSS LREAMGK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaatttcgatcaagccgatacccagttccaggtggtggtcaatgccgagcggcagtat tcgatctggccggagtacaagccggtgccggccggctggcaggagatcggcatctgcggc gaccgccagacctgcctggcgcacatctccgggatctggtcggatatgcgtccgagcagc ctgcgcgaagccatgggcaagtga

DBGET integrated database retrieval system