Azotobacter vinelandii DJ: Avin_25630 Help Entry Avin_25630        CDS       T00885                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism avn  Azotobacter vinelandii DJ Pathway avn00261   Monobactam biosynthesis avn01100   Metabolic pathways avn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:avn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Avin_25630  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:avn01008]     Avin_25630 Polyketide biosynthesis proteins [BR:avn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Avin_25630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACO78743 UniProt:  C1DIR2 LinkDB All DBs Position complement(2606842..2607084) Genome browser AA seq 80 aa AA seqDB search MISVFDREDIVFQVVVNHEEQYSIWPDYKEIPKGWRKAGKSGFKKECLAYIEEVWTDMRP LSLRKKMEAMAKEREGAAAN NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgatttctgttttcgatcgcgaggacatcgttttccaggtcgtcgtcaaccatgaggag cagtactccatctggccggactacaaggaaatccccaagggttggcgcaaggcaggcaag agcggcttcaagaaggaatgcctggcctacatcgaggaggtgtggaccgacatgcgtccc ctgagcctgcgcaagaagatggaggcgatggccaaggagcgcgaaggcgccgccgcgaac tga

DBGET integrated database retrieval system