Anabaena sp. WA102: AA650_13185 Help Entry AA650_13185       CDS       T04059                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism awa  Anabaena sp. WA102 Pathway awa00790   Folate biosynthesis awa01100   Metabolic pathways awa01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:awa00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     AA650_13185 Enzymes [BR:awa01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      AA650_13185  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      AA650_13185  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      AA650_13185 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CotE Motif Other DBs NCBI-ProteinID:  ALB43544 UniProt:  A0A0K2M6L5 LinkDB All DBs Position 3044609..3044977 Genome browser AA seq 122 aa AA seqDB search MDCIHLTGIRGYSYVGYLPEEKVLGQWFEVDLKLWVDLAQAAETDAIKDTVDYRNIISLV QNLLKTSKFDLLERLAGAIANAILQESSLTTQVQVILIKPAAPIPDFDGNIRIELTRSKS NL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggactgtattcatttaacagggattcgcggttatagctatgttgggtatttaccggag gaaaaggtattaggacaatggtttgaggtggatttgaaattatgggtcgatcttgctcaa gctgcggagactgatgctattaaagatactgtagattatcgtaatattattagtttagtc cagaacttgctaaaaacatctaaatttgatttattagaaaggttggcaggtgcgatcgct aatgctattcttcaagaaagtagtctaaccacccaagtacaagttattctcattaaacct gctgcaccaattcctgattttgatggtaatattcgcattgaattgactagaagtaaatcc aatctatag

DBGET integrated database retrieval system