Achromobacter xylosoxidans A8: AXYL_02592 Help Entry AXYL_02592        CDS       T01341                                  Symbol mbtH Name (GenBank) protein MbtH   KO K05375   MbtH protein Organism axy  Achromobacter xylosoxidans A8 Pathway axy00261   Monobactam biosynthesis axy01100   Metabolic pathways axy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:axy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AXYL_02592 (mbtH)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:axy01008]     AXYL_02592 (mbtH) Polyketide biosynthesis proteins [BR:axy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AXYL_02592 (mbtH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADP15912 UniProt:  E3HPS8 LinkDB All DBs Position 2752217..2752465 Genome browser AA seq 82 aa AA seqDB search MSTSCFDREDETFIVLVNHEEQYSIWPHWKAVPGGWRAVDGVKGDKKTVLDYVEKTWTDM RPLSLRKWMDEQAAARSDVAAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccagttgttttgaccgcgaggacgagaccttcatcgtcctcgtcaatcacgaa gagcagtactcgatctggcctcattggaaggcagtgcccggcggctggcgagccgtcgat ggagtcaagggagacaagaagaccgttctcgactacgtcgagaagacctggaccgacatg cgtccgctgtcgctgcgcaagtggatggacgaacaggccgcggcccgttccgacgtcgcg gcggcctga

DBGET integrated database retrieval system