Azoarcus sp. DN11: CDA09_03700 Help Entry CDA09_03700       CDS       T05691                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism azd  Azoarcus sp. DN11 Pathway azd00790   Folate biosynthesis azd01100   Metabolic pathways azd01240   Biosynthesis of cofactors Module azd_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:azd00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     CDA09_03700 Enzymes [BR:azd01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      CDA09_03700  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      CDA09_03700  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      CDA09_03700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AYH42498 LinkDB All DBs Position 832691..833068 Genome browser AA seq 125 aa AA seqDB search MDFIFIEDLRVEAWVGIYSREKAAPQIVELNLTFGVPDSAAEQDDIADTIDYAEVIERIR KELAERHFNLIETLGEFVVTLLLDEFGAPWVKIRVAKLGVMKGVRRVGVYIQRGREGVSL PPTTD NT seq 378 nt NT seq  +upstreamnt  +downstreamnt atggatttcattttcatcgaggatctgagggtagaggcctgggtcggtatctattcgcgc gagaaggctgcgccgcagatcgtcgagctcaatctcacattcggcgtccccgattctgcc gccgagcaggacgacatagccgacaccatcgattatgctgaggtgatcgagcgcatccgc aaggagctcgccgagcgccacttcaatctgatcgagaccctgggcgaatttgtcgtcaca ctgctgttggacgaatttggtgcgccctgggtaaagatccgcgtcgccaagctgggcgtg atgaagggcgtgcgccgcgtaggggtatatattcagcgtggtcgggaaggagtctccctc cccccgaccaccgactga

DBGET integrated database retrieval system