Azoarcus sp. DD4: CJ010_11505 Help Entry CJ010_11505       CDS       T06048                                  Name (GenBank) monooxygenase   KO K15763   toluene monooxygenase system protein D [EC:1.14.13.236 1.14.13.-] Organism azr  Azoarcus sp. DD4 Pathway azr00623   Toluene degradation azr01100   Metabolic pathways azr01120   Microbial metabolism in diverse environments azr01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:azr00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00623 Toluene degradation     CJ010_11505 Enzymes [BR:azr01000]  1. Oxidoreductases   1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen    1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor     1.14.13.236  toluene 4-monooxygenase      CJ010_11505 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MmoB_DmpM Motif Other DBs NCBI-ProteinID:  QDF97109 UniProt:  A0A4Y6KRR5 LinkDB All DBs Position complement(2481772..2482086) Genome browser AA seq 104 aa AA seqDB search MSTSNAGQAFHNNMVGPVMRAGDLAMAVIEAARLDNPGKEIFVEDKRAYIRIHAEQEMIL RQETIAEELGRPFRINELEVDLSSFAGQIESQPNAVRFYFTKTL NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgagcacgtcgaatgcaggacaggccttccacaacaacatggtcggcccggtgatgcgg gccggcgacctggccatggcggtgatcgaggcggccaggctggacaacccgggcaaggaa atcttcgtcgaggataaacgggcctacatccgtatccacgccgaacaggaaatgatcctg cgccaggaaaccatcgcggaagagctggggcgcccgttcaggatcaacgaactggaagtg gacctgagttccttcgccgggcagatcgagagtcagcccaacgccgtccgcttctacttc accaagaccttgtag

DBGET integrated database retrieval system