Burkholderia ambifaria MC40-6: BamMC406_1551 Help Entry BamMC406_1551     CDS       T00684                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bac  Burkholderia ambifaria MC40-6 Pathway bac00261   Monobactam biosynthesis bac01100   Metabolic pathways bac01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bac00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BamMC406_1551  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bac01008]     BamMC406_1551 Polyketide biosynthesis proteins [BR:bac01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BamMC406_1551 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACB64038 UniProt:  B1YQA0 LinkDB All DBs Position 1:1726796..1727038 Genome browser AA seq 80 aa AA seqDB search MTQASTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREVGVRGPKADCLAHIETVWT DMRPASLRRAMDGEPATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagcctcgacgccttccgccgacaccgacgacctggtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggccggtgccggccggctggcgc gaggtcggcgtgcgcggcccgaaggccgactgcctcgcgcacatcgagacggtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcccgcgacgcgcgcgtcg tga

DBGET integrated database retrieval system