Bacteroidales bacterium CF: BRDCF_p1266 Help Entry BRDCF_p1266       CDS       T02861                                  Symbol folB Name (GenBank) Dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bacc  Bacteroidales bacterium CF Pathway bacc00790   Folate biosynthesis bacc01100   Metabolic pathways bacc01240   Biosynthesis of cofactors Module bacc_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bacc00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BRDCF_p1266 (folB) Enzymes [BR:bacc01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BRDCF_p1266 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BRDCF_p1266 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BRDCF_p1266 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Cytokin_check_N PRONE Motif Other DBs NCBI-ProteinID:  AGY53893 UniProt:  U5Q612 LinkDB All DBs Position complement(1502462..1502827) Genome browser AA seq 121 aa AA seqDB search MMPDTNNYIELAGMEFFSYHGHYDEEQIVGNRFVVDLKVNADFSRASLSDDLFDTVDYQE LYSIVAEEMAIPSKLLESVAKRIIERLKKRYPQVKGATLSISKLNPSLGGQVGAARIVFS Y NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atgatgccagatacaaataactatattgaacttgccgggatggagtttttctcatatcac ggacattacgacgaagagcagattgttggaaaccgttttgtcgtagatttaaaggtaaat gcagatttttcaagggcaagtctgagtgacgatctttttgacactgtcgattatcaggag ttatacagcattgttgctgaagagatggcaattccttctaaacttcttgagagtgttgca aaacgaattattgaaaggcttaagaaaagataccctcaggtaaagggtgcaactctttct atttcaaagctaaatccatctctgggaggacaggttggggctgcgagaatcgtattttca tattaa

DBGET integrated database retrieval system