Bacillus sp. BS34A: BS34A_34920 Help Entry BS34A_34920       CDS       T03833                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bacl  Bacillus sp. BS34A Pathway bacl00261   Monobactam biosynthesis bacl01100   Metabolic pathways bacl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bacl00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BS34A_34920  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bacl01008]     BS34A_34920 Polyketide biosynthesis proteins [BR:bacl01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BS34A_34920 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CEJ78850 LinkDB All DBs Position I:complement(3298302..3298511) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system