Bacillus sp. OxB-1: OXB_1050 Help Entry OXB_1050          CDS       T03635                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism baco  Bacillus sp. OxB-1 Pathway baco00790   Folate biosynthesis baco01100   Metabolic pathways baco01240   Biosynthesis of cofactors Module baco_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:baco00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     OXB_1050 Enzymes [BR:baco01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      OXB_1050  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      OXB_1050  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      OXB_1050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BAQ09522 UniProt:  A0A0A8JGM3 LinkDB All DBs Position 1058854..1059222 Genome browser AA seq 122 aa AA seqDB search MDYIHLNEMQFFGYHGVLPEETKLGQRFRASVTLALDLSEAGKTDALEKTVNYAEVYSVC KSVVEGEPLKLIESVAEELADRILNSFGEQVLGVRVLLVKPDPPIHGHYASVAVEITRGR FT NT seq 369 nt NT seq  +upstreamnt  +downstreamnt gtggattatattcatttgaatgaaatgcagtttttcggatatcatggcgtcttgcccgaa gagacaaagctcgggcagcgttttagggcatccgtgacgctggcgctcgatttatcggaa gccggaaagacggatgcgttggagaagacggtgaattatgcggaagtgtacagtgtatgc aaatctgttgtagaaggagaaccgctcaagctgatcgagtccgtcgcggaagagctggcg gatcggattctgaacagtttcggggagcaagtgctcggcgtccgtgtcctgctcgtcaag cccgatccgccgatccatgggcattatgcttctgtagcagttgaaatcacaagggggcgg tttacgtga

DBGET integrated database retrieval system