Bacillus sp. WP8: QR42_18510 Help Entry QR42_18510        CDS       T03530                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bacw  Bacillus sp. WP8 Pathway bacw00261   Monobactam biosynthesis bacw01100   Metabolic pathways bacw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bacw00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     QR42_18510  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bacw01008]     QR42_18510 Polyketide biosynthesis proteins [BR:bacw01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     QR42_18510 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AIZ62138 UniProt:  A0A0B4SDA7 LinkDB All DBs Position 3672374..3672601 Genome browser AA seq 75 aa AA seqDB search MTNPFDREDGVFLVLVNEQGQHSLWPSFAPVPDGWEKVFGEDTRNACIDYIQTHWQDLRP LSLTKEPALAHGKTE NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccctttgatcgtgaagacggtgtatttcttgtgcttgtcaatgaacaagga cagcattcactttggccatcatttgcaccagtgccagatggatgggaaaaagtctttggt gaagacactagaaatgcctgcatcgattatatccagacacactggcaggacttgcggcca ttaagcttaacaaaagaacctgcactagcacatggaaaaacggaataa

DBGET integrated database retrieval system