Heyndrickxia coagulans 36D1: Bcoa_1223 Help Entry Bcoa_1223         CDS       T01628                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bag  Heyndrickxia coagulans 36D1 Pathway bag00790   Folate biosynthesis bag01100   Metabolic pathways bag01240   Biosynthesis of cofactors Module bag_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bag00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     Bcoa_1223 Enzymes [BR:bag01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      Bcoa_1223  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      Bcoa_1223  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      Bcoa_1223 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB DDE_3 Motif Other DBs NCBI-ProteinID:  AEP00431 UniProt:  G2THL4 LinkDB All DBs Position complement(1325865..1326233) Genome browser AA seq 122 aa AA seqDB search MDKIYIHDMEFYGYHGVLPEENKLGQRFRVSIVLGLDLKQAGETDRLEETVSYADVYACV KKIVEGQPFKLLEAVAEKLAASILALYEKVAEVTVKVTKPDPPIPGHYKSVAVEITRRRK NG NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atggacaaaatttatattcatgatatggaattttacggttaccacggcgtattgcccgag gaaaataaactgggccagcgcttccgtgtatccatcgtgcttggtttggacttaaagcag gcgggcgaaaccgaccggctggaagaaaccgtcagttatgcggatgtctatgcatgcgtg aaaaaaattgttgaagggcagcctttcaagctccttgaagctgtcgcagaaaaactggct gcttccattctcgctttatacgaaaaagttgcggaagtcacagtcaaagtaaccaaaccg gacccgcccattcccggccattacaagtccgttgcggtcgaaattacaaggagaagaaag aatggataa

DBGET integrated database retrieval system