Bacillus anthracis CDC 684: BAMEG_2227 Help Entry BAMEG_2227        CDS       T00886                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bah  Bacillus anthracis CDC 684 Pathway bah00261   Monobactam biosynthesis bah01100   Metabolic pathways bah01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bah00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAMEG_2227  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bah01008]     BAMEG_2227 Polyketide biosynthesis proteins [BR:bah01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAMEG_2227 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACP13435 LinkDB All DBs Position complement(2025198..2025422) Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system