Bacillus anthracis A0248: BAA_2431 Help Entry BAA_2431          CDS       T00892                                  Name (GenBank) mbtH-like protein   KO K05375   MbtH protein Organism bai  Bacillus anthracis A0248 Pathway bai00261   Monobactam biosynthesis bai01100   Metabolic pathways bai01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bai00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAA_2431  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bai01008]     BAA_2431 Polyketide biosynthesis proteins [BR:bai01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAA_2431 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ACQ49836 LinkDB All DBs Position 2213688..2213912 Genome browser AA seq 74 aa AA seqDB search MTNPFENDNYTYKVLKNEEGQYSLWPAFLDVPIGWNVVHKEASRNDCLQYVENNWEDLNP KSNQVGKKILVGKR NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgaaaatgataattacacatataaagtattaaaaaatgaggagggc cagtattctctctggcctgcctttcttgatgtacctattggttggaacgtcgtacataaa gaggctagtaggaatgattgtttacaatatgttgaaaataactgggaagatttgaatcca aaaagtaatcaagttggcaaaaaaatattagtaggaaaacgataa

DBGET integrated database retrieval system