Bacillus sp. LM 4-2: BsLM_3190 Help Entry BsLM_3190         CDS       T03908                                  Name (GenBank) putative MbtH-like protein   KO K05375   MbtH protein Organism balm  Bacillus sp. LM 4-2 Pathway balm00261   Monobactam biosynthesis balm01100   Metabolic pathways balm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:balm00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BsLM_3190  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:balm01008]     BsLM_3190 Polyketide biosynthesis proteins [BR:balm01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BsLM_3190 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AKE24987 LinkDB All DBs Position complement(3136277..3136486) Genome browser AA seq 69 aa AA seqDB search MANPFENADGTYLVLVNEEGQYSLWPGFIDVPSGWTVVHEQKGREACLDYIQSHWSDMRP NSLKTVENV NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggcaaatccttttgaaaatgcggatggcacatatttggtgctggtcaatgaagaaggc caatattccctatggccgggttttatagatgtgccgagcggctggacagtcgttcatgag caaaaagggcgtgaagcttgtttggactatatccaatcgcattggagcgatatgaggcca aacagcctaaagactgttgaaaatgtgtaa

DBGET integrated database retrieval system