Burkholderia ambifaria AMMD: Bamb_1530 Help Entry Bamb_1530         CDS       T00398                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism bam  Burkholderia ambifaria AMMD Pathway bam00261   Monobactam biosynthesis bam01100   Metabolic pathways bam01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bam00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Bamb_1530  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bam01008]     Bamb_1530 Polyketide biosynthesis proteins [BR:bam01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Bamb_1530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABI87088 UniProt:  Q0BFI5 LinkDB All DBs Position 1:1681723..1681965 Genome browser AA seq 80 aa AA seqDB search MTQATTPSADTDDLVYTVVINDEEQYSIWPTFRPVPAGWREAGVRGPKADCLAHIETVWT DMRPASLRRAMDGERATRAS NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacgcaagccacgacgccttccgccgacaccgacgacctggtctacacggtcgtcatc aacgacgaagaacagtattcgatctggccgacgttccggcccgtgccggccggctggcgc gaggccggcgtgcgcggcccgaaggccgactgcctcgcgcacatcgagacggtctggacc gacatgcgccccgcgagcctgcgccgcgcgatggacggcgagcgcgcgacgcgcgcgtcg tga

DBGET integrated database retrieval system