Bacillus velezensis NAU-B3: BAPNAU_0078 Help Entry BAPNAU_0078       CDS       T02859                                  Symbol folA Name (GenBank) dihydroneopterin aldolase FolA   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism bamb  Bacillus velezensis NAU-B3 Pathway bamb00790   Folate biosynthesis bamb01100   Metabolic pathways bamb01240   Biosynthesis of cofactors Module bamb_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:bamb00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     BAPNAU_0078 (folA) Enzymes [BR:bamb01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      BAPNAU_0078 (folA)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      BAPNAU_0078 (folA)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      BAPNAU_0078 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  CDH93859 LinkDB All DBs Position 87561..87923 Genome browser AA seq 120 aa AA seqDB search MDKVYVEGMEFYGYHGVFEEENKLGQRFKVDLTAELDLSKAGKTDDLSYTINYAELYSVC RGIVEGEPVNLVETLAERIADTVLKKFEPVQQCTVKVVKPDPPIPGHYKSVAIEMTRKKS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggataaagtatatgtggaaggtatggagttttacggatatcacggcgtgttcgaagaa gaaaacaaactcggccagcgcttcaaagtagacctgactgccgaactggatttgagcaaa gcgggaaaaacggatgacctttcttataccattaactatgcggaattgtacagtgtctgc cgcggcatcgttgagggcgagcccgttaatttggtcgagacccttgcggaacggatcgca gacaccgtccttaagaaatttgagccggtgcagcaatgtacggtaaaggttgttaagcct gacccgccgattcccggccattataaatcagtagctatagaaatgacgagaaagaaatca tga

DBGET integrated database retrieval system