Bacillus velezensis NAU-B3: BAPNAU_3079 Help Entry BAPNAU_3079       CDS       T02859                                  Symbol ybdZ Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bamb  Bacillus velezensis NAU-B3 Pathway bamb00261   Monobactam biosynthesis bamb01100   Metabolic pathways bamb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BAPNAU_3079 (ybdZ)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamb01008]     BAPNAU_3079 (ybdZ) Polyketide biosynthesis proteins [BR:bamb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BAPNAU_3079 (ybdZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CDH96859 LinkDB All DBs Position complement(3254014..3254229) Genome browser AA seq 71 aa AA seqDB search MTNPFEQEDGSYHVLVNAEGQYSLWPAYLDVPDGWETRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacaggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccggacggctgggaaacccgtctcacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaaacaggccgaagccgctaaaaaataa

DBGET integrated database retrieval system