Bacillus amyloliquefaciens CC178: U471_30060 Help Entry U471_30060        CDS       T02893                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bamc  Bacillus amyloliquefaciens CC178 Pathway bamc00261   Monobactam biosynthesis bamc01100   Metabolic pathways bamc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     U471_30060  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamc01008]     U471_30060 Polyketide biosynthesis proteins [BR:bamc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     U471_30060 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AGZ57704 LinkDB All DBs Position complement(3017937..3018152) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPGGWEIRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKK NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccgggcggctgggaaatacgcctcacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaaacaggccgaagccgctaaaaagtaa

DBGET integrated database retrieval system