Bacillus amyloliquefaciens LFB112: U722_15630 Help Entry U722_15630        CDS       T02965                                  Name (GenBank) protein mbtH   KO K05375   MbtH protein Organism bamf  Bacillus amyloliquefaciens LFB112 Pathway bamf00261   Monobactam biosynthesis bamf01100   Metabolic pathways bamf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     U722_15630  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamf01008]     U722_15630 Polyketide biosynthesis proteins [BR:bamf01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     U722_15630 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHC43469 LinkDB All DBs Position complement(3075013..3075228) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPDGWETRLTNETRPVCLEYIETNWRDMRP ESLKRTEAAKM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggttcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccggacggctgggaaacccgcctgacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaagcggaccgaagctgctaaaatgtaa

DBGET integrated database retrieval system