Bacillus velezensis UCMB5113: BASU_2822 Help Entry BASU_2822         CDS       T02796                                  Symbol ybdZ Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism bamn  Bacillus velezensis UCMB5113 Pathway bamn00261   Monobactam biosynthesis bamn01100   Metabolic pathways bamn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     BASU_2822 (ybdZ)  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamn01008]     BASU_2822 (ybdZ) Polyketide biosynthesis proteins [BR:bamn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     BASU_2822 (ybdZ) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CDG27105 LinkDB All DBs Position complement(3014163..3014378) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPDGWETRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccggacggctgggaaacccgcctcacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaaacaggccgaagccgctaaaatgtaa

DBGET integrated database retrieval system