Bacillus velezensis AS43.3: B938_14840 Help Entry B938_14840        CDS       T02382                                  Name (GenBank) hypothetical protein   KO K05375   MbtH protein Organism bamp  Bacillus velezensis AS43.3 Pathway bamp00261   Monobactam biosynthesis bamp01100   Metabolic pathways bamp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     B938_14840  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamp01008]     B938_14840 Polyketide biosynthesis proteins [BR:bamp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     B938_14840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFZ91978 LinkDB All DBs Position complement(3053738..3053953) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPDGWETRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccggacggctgggaaacccgcctcacg aatgaaacccgccccgtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcttgaaacaggccgaagccgctaaaatgtaa

DBGET integrated database retrieval system