Bacillus velezensis TrigoCor1448: AJ82_16415 Help Entry AJ82_16415        CDS       T03161                                  Name (GenBank) antibiotic transporter   KO K05375   MbtH protein Organism bamt  Bacillus velezensis TrigoCor1448 Pathway bamt00261   Monobactam biosynthesis bamt01100   Metabolic pathways bamt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:bamt00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AJ82_16415  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:bamt01008]     AJ82_16415 Polyketide biosynthesis proteins [BR:bamt01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AJ82_16415 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AHK50395 LinkDB All DBs Position complement(3053417..3053632) Genome browser AA seq 71 aa AA seqDB search MTNPFEREDGSYHVLVNAEGQYSLWPAYLDVPGGWEIRLTNETRPVCLEYIETNWRDMRP ESLKQAEAAKM NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgacaaatccatttgaacgggaagacggctcataccatgtgctcgtcaatgctgaaggc cagtactcactgtggccggcctatctggatgtgccgggcggctgggaaatacgcctcacg aatgaaacccgcccagtttgtctcgaatatattgaaacaaactggcgtgatatgaggccg gaaagcctgaaacaggccgaagccgctaaaatgtaa

DBGET integrated database retrieval system